Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2047191..2047490 | Replicon | chromosome |
| Accession | NZ_LR134093 | ||
| Organism | Staphylococcus aureus strain NCTC11965 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | ELZ56_RS10335 | Protein ID | WP_011447039.1 |
| Coordinates | 2047314..2047490 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2047191..2047246 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ56_RS10290 | 2042521..2042781 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| ELZ56_RS10295 | 2042834..2043184 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| ELZ56_RS10300 | 2043870..2044319 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| ELZ56_RS10305 | 2044414..2044749 | - | 336 | Protein_1909 | SH3 domain-containing protein | - |
| ELZ56_RS10315 | 2045399..2045890 | - | 492 | WP_000919350.1 | staphylokinase | - |
| ELZ56_RS10320 | 2046081..2046836 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ELZ56_RS10325 | 2046848..2047102 | - | 255 | WP_000611512.1 | phage holin | - |
| ELZ56_RS10330 | 2047154..2047261 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2047183..2047322 | + | 140 | NuclAT_0 | - | - |
| - | 2047183..2047322 | + | 140 | NuclAT_0 | - | - |
| - | 2047183..2047322 | + | 140 | NuclAT_0 | - | - |
| - | 2047183..2047322 | + | 140 | NuclAT_0 | - | - |
| - | 2047191..2047246 | + | 56 | - | - | Antitoxin |
| ELZ56_RS10335 | 2047314..2047490 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| ELZ56_RS10340 | 2047599..2048372 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| ELZ56_RS10350 | 2048793..2049167 | - | 375 | Protein_1916 | hypothetical protein | - |
| ELZ56_RS10355 | 2049223..2049510 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| ELZ56_RS10360 | 2049557..2049709 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / tsst-1 / groEL / hld | 2037060..2120318 | 83258 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286786 WP_011447039.1 NZ_LR134093:c2047490-2047314 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286786 NZ_LR134093:2047191-2047246 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|