Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1889889..1890069 | Replicon | chromosome |
Accession | NZ_LR134093 | ||
Organism | Staphylococcus aureus strain NCTC11965 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ELZ56_RS09330 | Protein ID | WP_001801861.1 |
Coordinates | 1889889..1889984 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1890012..1890069 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ56_RS09295 | 1885033..1885659 | + | 627 | WP_000669038.1 | hypothetical protein | - |
ELZ56_RS09300 | 1885700..1886044 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
ELZ56_RS09305 | 1886142..1886714 | + | 573 | WP_000414222.1 | hypothetical protein | - |
ELZ56_RS09310 | 1886863..1888230 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
ELZ56_RS09315 | 1888230..1888799 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
ELZ56_RS09320 | 1888992..1889438 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
ELZ56_RS09330 | 1889889..1889984 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1890012..1890069 | - | 58 | - | - | Antitoxin |
ELZ56_RS09335 | 1890107..1890208 | + | 102 | WP_001791232.1 | hypothetical protein | - |
ELZ56_RS09340 | 1890383..1890826 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
ELZ56_RS09345 | 1890826..1891269 | - | 444 | WP_115307081.1 | DUF1433 domain-containing protein | - |
ELZ56_RS09350 | 1891269..1891711 | - | 443 | Protein_1762 | DUF1433 domain-containing protein | - |
ELZ56_RS09355 | 1892236..1894656 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286783 WP_001801861.1 NZ_LR134093:1889889-1889984 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT286783 NZ_LR134093:c1890069-1890012 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|