Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2436399..2436583 | Replicon | chromosome |
Accession | NZ_LR134091 | ||
Organism | Staphylococcus aureus strain NCTC4137 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | ELZ58_RS12695 | Protein ID | WP_000482647.1 |
Coordinates | 2436476..2436583 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2436399..2436459 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ58_RS12670 | 2431853..2432020 | - | 168 | WP_001790576.1 | hypothetical protein | - |
ELZ58_RS12680 | 2432251..2433984 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
ELZ58_RS12685 | 2434009..2435772 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein/permease | - |
- | 2436399..2436459 | + | 61 | - | - | Antitoxin |
ELZ58_RS12695 | 2436476..2436583 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ELZ58_RS12700 | 2436717..2437103 | - | 387 | WP_000779360.1 | flippase GtxA | - |
ELZ58_RS12705 | 2437361..2438503 | + | 1143 | WP_042727740.1 | glycerate kinase | - |
ELZ58_RS12710 | 2438563..2439222 | + | 660 | WP_000831298.1 | membrane protein | - |
ELZ58_RS12715 | 2439404..2440615 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
ELZ58_RS12720 | 2440738..2441211 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T286753 WP_000482647.1 NZ_LR134091:c2436583-2436476 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286753 NZ_LR134091:2436399-2436459 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|