Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1979725..1980024 | Replicon | chromosome |
Accession | NZ_LR134091 | ||
Organism | Staphylococcus aureus strain NCTC4137 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | ELZ58_RS10130 | Protein ID | WP_072353918.1 |
Coordinates | 1979848..1980024 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1979725..1979780 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ58_RS10075 | 1975283..1975462 | + | 180 | WP_000669789.1 | hypothetical protein | - |
ELZ58_RS10085 | 1975773..1976033 | + | 261 | WP_001791826.1 | hypothetical protein | - |
ELZ58_RS10090 | 1976086..1976436 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
ELZ58_RS10095 | 1976946..1977281 | - | 336 | Protein_1858 | SH3 domain-containing protein | - |
ELZ58_RS10110 | 1977933..1978424 | - | 492 | WP_000920041.1 | staphylokinase | - |
ELZ58_RS10115 | 1978615..1979370 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
ELZ58_RS10120 | 1979382..1979636 | - | 255 | WP_000611512.1 | phage holin | - |
ELZ58_RS10125 | 1979688..1979795 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1979717..1979856 | + | 140 | NuclAT_0 | - | - |
- | 1979717..1979856 | + | 140 | NuclAT_0 | - | - |
- | 1979717..1979856 | + | 140 | NuclAT_0 | - | - |
- | 1979717..1979856 | + | 140 | NuclAT_0 | - | - |
- | 1979725..1979780 | + | 56 | - | - | Antitoxin |
ELZ58_RS10130 | 1979848..1980024 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
ELZ58_RS10135 | 1980167..1980541 | - | 375 | WP_000340977.1 | hypothetical protein | - |
ELZ58_RS10140 | 1980597..1980884 | - | 288 | WP_001262620.1 | hypothetical protein | - |
ELZ58_RS10145 | 1980930..1981082 | - | 153 | WP_001000058.1 | hypothetical protein | - |
ELZ58_RS10150 | 1981075..1984857 | - | 3783 | WP_001836550.1 | phage protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1976086..2030692 | 54606 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T286748 WP_072353918.1 NZ_LR134091:c1980024-1979848 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286748 NZ_LR134091:1979725-1979780 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|