Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
| Location | 2245241..2245439 | Replicon | chromosome |
| Accession | NZ_LR134090 | ||
| Organism | Staphylococcus aureus strain NCTC9555 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | ELZ60_RS11775 | Protein ID | WP_001802298.1 |
| Coordinates | 2245335..2245439 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2245241..2245279 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ60_RS11755 | 2241350..2242015 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
| ELZ60_RS11760 | 2242167..2242487 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| ELZ60_RS11765 | 2242489..2243469 | + | 981 | WP_000019740.1 | CDF family zinc efflux transporter CzrB | - |
| ELZ60_RS11770 | 2243735..2244826 | + | 1092 | WP_000495692.1 | hypothetical protein | - |
| - | 2245241..2245279 | + | 39 | - | - | Antitoxin |
| ELZ60_RS11775 | 2245335..2245439 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| ELZ60_RS14865 | 2245600..2246083 | - | 484 | Protein_2172 | recombinase family protein | - |
| ELZ60_RS11785 | 2246126..2247246 | - | 1121 | Protein_2173 | SAP domain-containing protein | - |
| ELZ60_RS11790 | 2248295..2249152 | - | 858 | WP_000370943.1 | Cof-type HAD-IIB family hydrolase | - |
| ELZ60_RS11795 | 2249220..2250002 | - | 783 | WP_000909235.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286742 WP_001802298.1 NZ_LR134090:c2245439-2245335 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT286742 NZ_LR134090:2245241-2245279 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|