Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1893249..1893429 Replicon chromosome
Accession NZ_LR134090
Organism Staphylococcus aureus strain NCTC9555

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag ELZ60_RS09620 Protein ID WP_001801861.1
Coordinates 1893249..1893344 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1893372..1893429 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ELZ60_RS09585 1888653..1889279 + 627 WP_000669034.1 hypothetical protein -
ELZ60_RS09590 1889320..1889661 + 342 WP_000627544.1 DUF3969 family protein -
ELZ60_RS09595 1889762..1890334 + 573 WP_000414210.1 hypothetical protein -
ELZ60_RS09600 1890710..1891546 + 837 WP_000190484.1 ABC transporter ATP-binding protein -
ELZ60_RS09610 1892352..1892798 - 447 WP_000747806.1 DUF1433 domain-containing protein -
ELZ60_RS09620 1893249..1893344 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1893372..1893429 - 58 - - Antitoxin
ELZ60_RS09625 1893467..1893568 + 102 WP_001791232.1 hypothetical protein -
ELZ60_RS09630 1893554..1893733 - 180 Protein_1805 transposase -
ELZ60_RS09635 1893921..1894295 - 375 WP_000695817.1 DUF1433 domain-containing protein -
ELZ60_RS09640 1894285..1894665 - 381 WP_001035978.1 DUF1433 domain-containing protein -
ELZ60_RS09645 1894873..1895313 - 441 WP_000759945.1 DUF1433 domain-containing protein -
ELZ60_RS09650 1895358..1896971 + 1614 WP_000926709.1 hypothetical protein -
ELZ60_RS09655 1896986..1897285 + 300 WP_000095391.1 WXG100 family type VII secretion target -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / lukD / lukS-PV / lukS-PV 1891534..1924748 33214


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286737 WP_001801861.1 NZ_LR134090:1893249-1893344 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT286737 NZ_LR134090:c1893429-1893372 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References