Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | holin-SprF3/- |
| Location | 358145..358663 | Replicon | chromosome |
| Accession | NZ_LR134090 | ||
| Organism | Staphylococcus aureus strain NCTC9555 | ||
Toxin (Protein)
| Gene name | holin | Uniprot ID | - |
| Locus tag | ELZ60_RS01770 | Protein ID | WP_000448764.1 |
| Coordinates | 358361..358663 (+) | Length | 101 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 358145..358281 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ60_RS01730 | 353239..353529 | + | 291 | WP_000179860.1 | hypothetical protein | - |
| ELZ60_RS01735 | 353545..355455 | + | 1911 | WP_000429563.1 | hypothetical protein | - |
| ELZ60_RS01740 | 355455..356921 | + | 1467 | WP_000067157.1 | BppU family phage baseplate upper protein | - |
| ELZ60_RS01745 | 356921..357310 | + | 390 | WP_001166604.1 | DUF2977 domain-containing protein | - |
| ELZ60_RS01750 | 357303..357467 | + | 165 | WP_000916020.1 | XkdX family protein | - |
| ELZ60_RS01755 | 357513..357812 | + | 300 | WP_000466773.1 | DUF2951 family protein | - |
| ELZ60_RS14885 | 357964..358153 | + | 190 | Protein_333 | putative holin-like toxin | - |
| - | 358145..358281 | - | 137 | NuclAT_0 | - | Antitoxin |
| - | 358145..358281 | - | 137 | NuclAT_0 | - | Antitoxin |
| - | 358145..358281 | - | 137 | NuclAT_0 | - | Antitoxin |
| - | 358145..358281 | - | 137 | NuclAT_0 | - | Antitoxin |
| ELZ60_RS01765 | 358200..358310 | - | 111 | WP_070003492.1 | hypothetical protein | - |
| ELZ60_RS01770 | 358361..358663 | + | 303 | WP_000448764.1 | phage holin | Toxin |
| ELZ60_RS01775 | 358675..360129 | + | 1455 | WP_000930278.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ELZ60_RS01785 | 361643..362140 | + | 498 | WP_001803960.1 | hypothetical protein | - |
| ELZ60_RS01795 | 362700..363527 | - | 828 | WP_000136028.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 317350..360129 | 42779 | |
| - | inside | Prophage | - | geh | 312793..360129 | 47336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11230.99 Da Isoelectric Point: 9.6587
>T286733 WP_000448764.1 NZ_LR134090:358361-358663 [Staphylococcus aureus]
METKVITRYIVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTAYKDNPTSQEGRWANQKLKKYKAENKYRKATG
QAPIKEVMTPTNMNDTNDLG
METKVITRYIVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTAYKDNPTSQEGRWANQKLKKYKAENKYRKATG
QAPIKEVMTPTNMNDTNDLG
Download Length: 303 bp
Antitoxin
Download Length: 137 bp
>AT286733 NZ_LR134090:c358281-358145 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGACCTCTGTAGTTAAAT
GAATTTATATAATCCTCTAACCATCGTACTCGTCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGACCTCTGTAGTTAAAT
GAATTTATATAATCCTCTAACCATCGTACTCGTCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|