Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2600638..2600795 | Replicon | chromosome |
| Accession | NZ_LR134089 | ||
| Organism | Staphylococcus saprophyticus strain NCTC7666 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | ELZ48_RS12685 | Protein ID | WP_002441941.1 |
| Coordinates | 2600700..2600795 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2600638..2600671 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ48_RS12660 | 2595645..2596478 | + | 834 | WP_041080289.1 | aldo/keto reductase | - |
| ELZ48_RS12665 | 2596945..2597244 | - | 300 | WP_011304021.1 | hypothetical protein | - |
| ELZ48_RS12670 | 2597620..2597856 | + | 237 | WP_115338747.1 | ferrous iron transport protein A | - |
| ELZ48_RS12675 | 2597849..2599843 | + | 1995 | WP_126424559.1 | ferrous iron transport protein B | - |
| ELZ48_RS12680 | 2599856..2600011 | + | 156 | WP_075340076.1 | FeoB-associated Cys-rich membrane protein | - |
| ELZ48_RS12845 | 2600256..2600393 | + | 138 | WP_002484366.1 | hypothetical protein | - |
| - | 2600638..2600671 | + | 34 | - | - | Antitoxin |
| ELZ48_RS12685 | 2600700..2600795 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| ELZ48_RS12690 | 2601098..2601856 | - | 759 | WP_002484367.1 | MerR family transcriptional regulator | - |
| ELZ48_RS12695 | 2601966..2602529 | - | 564 | WP_126424560.1 | helix-turn-helix domain-containing protein | - |
| ELZ48_RS12700 | 2602723..2604180 | - | 1458 | WP_126424561.1 | carbon starvation protein A | - |
| ELZ48_RS12705 | 2604388..2605227 | - | 840 | WP_002481957.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T286731 WP_002441941.1 NZ_LR134089:c2600795-2600700 [Staphylococcus saprophyticus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
Antitoxin
Download Length: 34 bp
>AT286731 NZ_LR134089:2600638-2600671 [Staphylococcus saprophyticus]
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|