Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2519647..2519831 | Replicon | chromosome |
Accession | NZ_LR134087 | ||
Organism | Staphylococcus aureus strain NCTC7121 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | ELZ50_RS13200 | Protein ID | WP_000482647.1 |
Coordinates | 2519724..2519831 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2519647..2519707 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ50_RS13175 | 2515101..2515268 | - | 168 | WP_001790576.1 | hypothetical protein | - |
ELZ50_RS13185 | 2515499..2517232 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
ELZ50_RS13190 | 2517257..2519020 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein/permease | - |
- | 2519647..2519707 | + | 61 | - | - | Antitoxin |
ELZ50_RS13200 | 2519724..2519831 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ELZ50_RS13205 | 2519965..2520351 | - | 387 | WP_000779360.1 | flippase GtxA | - |
ELZ50_RS13210 | 2520609..2521751 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
ELZ50_RS13215 | 2521811..2522470 | + | 660 | WP_000831298.1 | membrane protein | - |
ELZ50_RS13220 | 2522652..2523863 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
ELZ50_RS13225 | 2523986..2524459 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T286726 WP_000482647.1 NZ_LR134087:c2519831-2519724 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286726 NZ_LR134087:2519647-2519707 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|