Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2047899..2048198 | Replicon | chromosome |
| Accession | NZ_LR134087 | ||
| Organism | Staphylococcus aureus strain NCTC7121 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | ELZ50_RS10525 | Protein ID | WP_072353918.1 |
| Coordinates | 2048022..2048198 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2047899..2047954 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ50_RS10470 | 2043457..2043636 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| ELZ50_RS10480 | 2043947..2044207 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| ELZ50_RS10485 | 2044260..2044610 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| ELZ50_RS10490 | 2045120..2045455 | - | 336 | Protein_1941 | SH3 domain-containing protein | - |
| ELZ50_RS10505 | 2046107..2046598 | - | 492 | WP_000920041.1 | staphylokinase | - |
| ELZ50_RS10510 | 2046789..2047544 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ELZ50_RS10515 | 2047556..2047810 | - | 255 | WP_000611512.1 | phage holin | - |
| ELZ50_RS10520 | 2047862..2047969 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2047891..2048030 | + | 140 | NuclAT_0 | - | - |
| - | 2047891..2048030 | + | 140 | NuclAT_0 | - | - |
| - | 2047891..2048030 | + | 140 | NuclAT_0 | - | - |
| - | 2047891..2048030 | + | 140 | NuclAT_0 | - | - |
| - | 2047899..2047954 | + | 56 | - | - | Antitoxin |
| ELZ50_RS10525 | 2048022..2048198 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
| ELZ50_RS10530 | 2048341..2048715 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| ELZ50_RS10535 | 2048771..2049058 | - | 288 | WP_001262620.1 | hypothetical protein | - |
| ELZ50_RS10540 | 2049104..2049256 | - | 153 | WP_001000058.1 | hypothetical protein | - |
| ELZ50_RS10545 | 2049249..2053031 | - | 3783 | WP_001836550.1 | phage protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / hlb / groEL | 2044260..2112792 | 68532 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T286720 WP_072353918.1 NZ_LR134087:c2048198-2048022 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286720 NZ_LR134087:2047899-2047954 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|