Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2525858..2526042 | Replicon | chromosome |
Accession | NZ_LR134086 | ||
Organism | Staphylococcus aureus strain NCTC13142 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | ELZ49_RS13095 | Protein ID | WP_000482647.1 |
Coordinates | 2525935..2526042 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2525858..2525918 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ49_RS13085 | 2521654..2523387 | - | 1734 | WP_000486501.1 | ABC transporter ATP-binding protein/permease | - |
ELZ49_RS13090 | 2523412..2525175 | - | 1764 | WP_001064811.1 | ABC transporter ATP-binding protein/permease | - |
- | 2525858..2525918 | + | 61 | - | - | Antitoxin |
ELZ49_RS13095 | 2525935..2526042 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ELZ49_RS13100 | 2526176..2526562 | - | 387 | WP_000779356.1 | flippase GtxA | - |
ELZ49_RS13105 | 2526830..2527972 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
ELZ49_RS13110 | 2528032..2528691 | + | 660 | WP_000831298.1 | membrane protein | - |
ELZ49_RS13115 | 2528870..2530081 | + | 1212 | WP_001191976.1 | multidrug effflux MFS transporter | - |
ELZ49_RS13120 | 2530204..2530677 | - | 474 | WP_000456498.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T286716 WP_000482647.1 NZ_LR134086:c2526042-2525935 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286716 NZ_LR134086:2525858-2525918 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|