Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2239026..2239243 | Replicon | chromosome |
Accession | NZ_LR134086 | ||
Organism | Staphylococcus aureus strain NCTC13142 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | ELZ49_RS11550 | Protein ID | WP_075583739.1 |
Coordinates | 2239139..2239243 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2239026..2239081 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ49_RS11530 | 2235148..2235813 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
ELZ49_RS11535 | 2235965..2236285 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
ELZ49_RS11540 | 2236287..2237267 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
ELZ49_RS11545 | 2237533..2238624 | + | 1092 | WP_000495678.1 | hypothetical protein | - |
- | 2239026..2239081 | + | 56 | - | - | Antitoxin |
ELZ49_RS11550 | 2239139..2239243 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
ELZ49_RS11555 | 2239341..2239502 | - | 162 | Protein_2151 | helix-turn-helix domain-containing protein | - |
ELZ49_RS11565 | 2239920..2240078 | + | 159 | WP_024928151.1 | hypothetical protein | - |
ELZ49_RS11575 | 2240738..2241595 | - | 858 | WP_000370944.1 | Cof-type HAD-IIB family hydrolase | - |
ELZ49_RS11580 | 2241663..2242445 | - | 783 | WP_000908181.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T286713 WP_075583739.1 NZ_LR134086:c2239243-2239139 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT286713 NZ_LR134086:2239026-2239081 [Staphylococcus aureus]
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|