Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF2/- |
| Location | 2058596..2058895 | Replicon | chromosome |
| Accession | NZ_LR134086 | ||
| Organism | Staphylococcus aureus strain NCTC13142 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | ELZ49_RS10500 | Protein ID | WP_011447039.1 |
| Coordinates | 2058719..2058895 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF2 | ||
| Locus tag | - | ||
| Coordinates | 2058596..2058651 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ49_RS10455 | 2053927..2054187 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| ELZ49_RS10460 | 2054240..2054590 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| ELZ49_RS10465 | 2055275..2055724 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| ELZ49_RS10470 | 2055819..2056154 | - | 336 | Protein_1945 | SH3 domain-containing protein | - |
| ELZ49_RS10480 | 2056804..2057295 | - | 492 | WP_000919349.1 | staphylokinase | - |
| ELZ49_RS10485 | 2057486..2058241 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ELZ49_RS10490 | 2058253..2058507 | - | 255 | WP_000611512.1 | phage holin | - |
| ELZ49_RS10495 | 2058559..2058666 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2058588..2058727 | + | 140 | NuclAT_1 | - | - |
| - | 2058588..2058727 | + | 140 | NuclAT_1 | - | - |
| - | 2058588..2058727 | + | 140 | NuclAT_1 | - | - |
| - | 2058588..2058727 | + | 140 | NuclAT_1 | - | - |
| - | 2058596..2058651 | + | 56 | - | - | Antitoxin |
| ELZ49_RS10500 | 2058719..2058895 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| ELZ49_RS10505 | 2059045..2059341 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| ELZ49_RS10510 | 2059399..2059686 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| ELZ49_RS10515 | 2059733..2059885 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| ELZ49_RS10520 | 2059875..2063660 | - | 3786 | WP_000582168.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL / hld | 2054240..2133417 | 79177 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286710 WP_011447039.1 NZ_LR134086:c2058895-2058719 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286710 NZ_LR134086:2058596-2058651 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|