Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1905199..1905378 | Replicon | chromosome |
| Accession | NZ_LR134086 | ||
| Organism | Staphylococcus aureus strain NCTC13142 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | ELZ49_RS09470 | Protein ID | WP_001801861.1 |
| Coordinates | 1905199..1905294 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1905322..1905378 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELZ49_RS09425 | 1900980..1901606 | + | 627 | WP_000669029.1 | hypothetical protein | - |
| ELZ49_RS09430 | 1901647..1901988 | + | 342 | WP_000627536.1 | DUF3969 family protein | - |
| ELZ49_RS09435 | 1902089..1902661 | + | 573 | WP_000414208.1 | hypothetical protein | - |
| ELZ49_RS09440 | 1902858..1903427 | - | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ELZ49_RS09450 | 1903800..1903976 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| ELZ49_RS09455 | 1903987..1904370 | - | 384 | WP_000070809.1 | hypothetical protein | - |
| ELZ49_RS09460 | 1904552..1904776 | - | 225 | WP_001805677.1 | IS3 family transposase | - |
| ELZ49_RS09465 | 1904950..1905054 | - | 105 | WP_001670380.1 | transposase | - |
| ELZ49_RS09470 | 1905199..1905294 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1905322..1905378 | - | 57 | - | - | Antitoxin |
| ELZ49_RS09475 | 1905416..1905517 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| ELZ49_RS09480 | 1905495..1905667 | - | 173 | Protein_1799 | transposase | - |
| ELZ49_RS09485 | 1905861..1906238 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
| ELZ49_RS09490 | 1906444..1906884 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
| ELZ49_RS09495 | 1906928..1908541 | + | 1614 | WP_000926708.1 | lipase | - |
| ELZ49_RS09500 | 1908556..1908855 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| ELZ49_RS09505 | 1909172..1910352 | - | 1181 | Protein_1804 | phosphoribosyl transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1878050..1921606 | 43556 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286707 WP_001801861.1 NZ_LR134086:1905199-1905294 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 57 bp
>AT286707 NZ_LR134086:c1905378-1905322 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
