Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1538367..1538666 | Replicon | chromosome |
Accession | NZ_LR134086 | ||
Organism | Staphylococcus aureus strain NCTC13142 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | ELZ49_RS07525 | Protein ID | WP_011447039.1 |
Coordinates | 1538490..1538666 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1538367..1538422 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ49_RS14780 | 1533601..1533816 | - | 216 | WP_170267452.1 | hypothetical protein | - |
ELZ49_RS07500 | 1533995..1535005 | - | 1011 | WP_000777019.1 | restriction endonuclease subunit S | - |
ELZ49_RS07505 | 1534992..1536896 | - | 1905 | WP_001003363.1 | N-6 DNA methylase | - |
ELZ49_RS07510 | 1537257..1538012 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
ELZ49_RS07515 | 1538024..1538278 | - | 255 | WP_000611512.1 | phage holin | - |
ELZ49_RS07520 | 1538330..1538437 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1538359..1538498 | + | 140 | NuclAT_0 | - | - |
- | 1538359..1538498 | + | 140 | NuclAT_0 | - | - |
- | 1538359..1538498 | + | 140 | NuclAT_0 | - | - |
- | 1538359..1538498 | + | 140 | NuclAT_0 | - | - |
- | 1538367..1538422 | + | 56 | - | - | Antitoxin |
ELZ49_RS07525 | 1538490..1538666 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
ELZ49_RS07530 | 1538819..1539118 | - | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
ELZ49_RS07535 | 1539164..1539328 | - | 165 | WP_000916020.1 | XkdX family protein | - |
ELZ49_RS07540 | 1539321..1539710 | - | 390 | WP_001166596.1 | DUF2977 domain-containing protein | - |
ELZ49_RS07545 | 1539710..1541175 | - | 1466 | Protein_1420 | phage baseplate upper protein | - |
ELZ49_RS07550 | 1541175..1543084 | - | 1910 | Protein_1421 | hypothetical protein | - |
ELZ49_RS07555 | 1543100..1543390 | - | 291 | WP_000179858.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1533601..1599764 | 66163 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286703 WP_011447039.1 NZ_LR134086:c1538666-1538490 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286703 NZ_LR134086:1538367-1538422 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|