Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3662955..3663649 Replicon chromosome
Accession NZ_LR134082
Organism Escherichia coli strain NCTC9038

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag EL018_RS17865 Protein ID WP_001263489.1
Coordinates 3662955..3663353 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag EL018_RS17870 Protein ID WP_000554758.1
Coordinates 3663356..3663649 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- 3658543..3658623 - 81 NuclAT_11 - -
- 3658543..3658623 - 81 NuclAT_11 - -
- 3658543..3658623 - 81 NuclAT_11 - -
- 3658543..3658623 - 81 NuclAT_11 - -
EL018_RS17840 3659219..3659677 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL018_RS17845 3659938..3661395 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
EL018_RS17850 3661452..3661973 - 522 Protein_3461 peptide chain release factor H -
EL018_RS17855 3661969..3662175 - 207 Protein_3462 RtcB family protein -
EL018_RS17860 3662493..3662945 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
EL018_RS17865 3662955..3663353 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL018_RS17870 3663356..3663649 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL018_RS17875 3663701..3664756 - 1056 WP_001226164.1 DNA polymerase IV -
EL018_RS17880 3664827..3665612 - 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
EL018_RS17885 3665584..3667296 + 1713 Protein_3468 flagellar biosynthesis protein FlhA -
EL018_RS17890 3667520..3668017 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA / rhs/PAAR / clpV/tssH / hcp1/tssD1 3638373..3696434 58061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T286682 WP_001263489.1 NZ_LR134082:c3663353-3662955 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT286682 WP_000554758.1 NZ_LR134082:c3663649-3663356 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References