Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4832176..4832778 | Replicon | chromosome |
| Accession | NZ_LR134080 | ||
| Organism | Escherichia coli strain NCTC9082 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | EL023_RS23745 | Protein ID | WP_000897305.1 |
| Coordinates | 4832467..4832778 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL023_RS23740 | Protein ID | WP_000356397.1 |
| Coordinates | 4832176..4832466 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL023_RS23710 | 4827723..4828358 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EL023_RS23715 | 4828355..4829284 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| EL023_RS23725 | 4829683..4830663 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
| EL023_RS23730 | 4830892..4831134 | - | 243 | WP_001086388.1 | hypothetical protein | - |
| EL023_RS23735 | 4831353..4831571 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
| EL023_RS23740 | 4832176..4832466 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL023_RS23745 | 4832467..4832778 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| EL023_RS23750 | 4833007..4833915 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| EL023_RS23755 | 4833979..4834920 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
| EL023_RS23760 | 4834965..4835402 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EL023_RS23765 | 4835399..4836271 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| EL023_RS23770 | 4836265..4836864 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4829683..4830663 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T286668 WP_000897305.1 NZ_LR134080:c4832778-4832467 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|