Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 2521309..2521936 Replicon chromosome
Accession NZ_LR134079
Organism Escherichia coli strain NCTC9112

Toxin (Protein)


Gene name higB Uniprot ID A0A0Q3ID11
Locus tag EL053_RS12655 Protein ID WP_016232083.1
Coordinates 2521607..2521936 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag EL053_RS12650 Protein ID WP_000147082.1
Coordinates 2521309..2521617 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL053_RS12605 2516334..2516558 + 225 WP_001054988.1 helix-turn-helix domain-containing protein -
EL053_RS12610 2516675..2516971 + 297 WP_000084293.1 hypothetical protein -
EL053_RS12615 2516986..2517204 + 219 WP_000438870.1 hypothetical protein -
EL053_RS12620 2517225..2518313 + 1089 WP_021571293.1 hypothetical protein -
EL053_RS12625 2518320..2519060 + 741 WP_021571292.1 ATP-binding protein -
EL053_RS12630 2519086..2519856 + 771 WP_046623299.1 DUF1627 domain-containing protein -
EL053_RS12635 2519872..2520303 + 432 WP_000196185.1 DUF977 family protein -
EL053_RS12640 2520336..2521010 - 675 WP_032144013.1 DUF4145 domain-containing protein -
EL053_RS12645 2521009..2521254 + 246 WP_001624507.1 hypothetical protein -
EL053_RS12650 2521309..2521617 - 309 WP_000147082.1 helix-turn-helix transcriptional regulator Antitoxin
EL053_RS12655 2521607..2521936 - 330 WP_016232083.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL053_RS12660 2522254..2522928 + 675 WP_021571289.1 ORF6N domain-containing protein -
EL053_RS12665 2522983..2523393 + 411 WP_001076830.1 recombination protein NinB -
EL053_RS12670 2523390..2523581 + 192 WP_001254269.1 NinE family protein -
EL053_RS12675 2523605..2523895 + 291 WP_024194163.1 DUF1364 domain-containing protein -
EL053_RS12680 2523892..2524254 + 363 WP_001624518.1 RusA family crossover junction endodeoxyribonuclease -
EL053_RS12685 2524251..2524451 + 201 WP_000994506.1 protein ninH -
EL053_RS12690 2524444..2524686 + 243 WP_001624519.1 hypothetical protein -
EL053_RS12695 2524686..2525300 + 615 WP_001241329.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2505277..2603406 98129
- inside Prophage - - 2506133..2603406 97273


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(15-103)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12714.71 Da        Isoelectric Point: 9.2605

>T286635 WP_016232083.1 NZ_LR134079:c2521936-2521607 [Escherichia coli]
INYIIEYYSDEVEAEILSLPETLQARYIRYTEKMRIYGANLGSPHTEAFGDGLFEIRLKGSEGIGRVFYCTLKGKRIIML
HSFVKKTQKTPPAELRKAETRMKEVKHDW

Download         Length: 330 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11079.81 Da        Isoelectric Point: 9.7256

>AT286635 WP_000147082.1 NZ_LR134079:c2521617-2521309 [Escherichia coli]
MTGKRTPPTMTHDEMVEKMLSNPAVKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLASGTSG
PSFATLKKFARATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q3ID11

Antitoxin

Source ID Structure

References