Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4747818..4748420 | Replicon | chromosome |
| Accession | NZ_LR134031 | ||
| Organism | Escherichia coli strain NCTC11151 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | EL024_RS23595 | Protein ID | WP_000897302.1 |
| Coordinates | 4748109..4748420 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL024_RS23590 | Protein ID | WP_000356397.1 |
| Coordinates | 4747818..4748108 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL024_RS23555 | 4743891..4744793 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| EL024_RS23560 | 4744790..4745425 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EL024_RS23565 | 4745422..4746351 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| EL024_RS23570 | 4746567..4746785 | - | 219 | WP_001314326.1 | ribbon-helix-helix domain-containing protein | - |
| EL024_RS23580 | 4747181..4747459 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| EL024_RS23590 | 4747818..4748108 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL024_RS23595 | 4748109..4748420 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| EL024_RS23600 | 4748649..4749557 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| EL024_RS23605 | 4749621..4750562 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| EL024_RS23610 | 4750607..4751044 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EL024_RS23615 | 4751041..4751913 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| EL024_RS23620 | 4751907..4752506 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T286603 WP_000897302.1 NZ_LR134031:c4748420-4748109 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|