Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
| Location | 4178694..4179106 | Replicon | chromosome |
| Accession | NZ_LR134031 | ||
| Organism | Escherichia coli strain NCTC11151 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | A0A8E0IWC4 |
| Locus tag | EL024_RS20835 | Protein ID | WP_001513534.1 |
| Coordinates | 4178765..4179106 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4178694..4178770 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL024_RS20825 | 4175306..4176775 | + | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
| EL024_RS20830 | 4176775..4178544 | + | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
| - | 4178694..4178770 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4178694..4178770 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4178694..4178770 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4178694..4178770 | - | 77 | NuclAT_6 | - | Antitoxin |
| - | 4178694..4178770 | - | 77 | NuclAT_7 | - | Antitoxin |
| - | 4178694..4178770 | - | 77 | NuclAT_7 | - | Antitoxin |
| - | 4178694..4178770 | - | 77 | NuclAT_7 | - | Antitoxin |
| - | 4178694..4178770 | - | 77 | NuclAT_7 | - | Antitoxin |
| EL024_RS20835 | 4178765..4179106 | + | 342 | WP_001513534.1 | endoribonuclease SymE | Toxin |
| EL024_RS20840 | 4179153..4181309 | - | 2157 | WP_001513533.1 | DUF262 domain-containing protein | - |
| EL024_RS20845 | 4181344..4181424 | - | 81 | WP_020233658.1 | hypothetical protein | - |
| EL024_RS20850 | 4181652..4182572 | - | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| EL024_RS20855 | 4182757..4184037 | + | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4163082..4179106 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12247.03 Da Isoelectric Point: 7.8545
>T286597 WP_001513534.1 NZ_LR134031:4178765-4179106 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT286597 NZ_LR134031:c4178770-4178694 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|