Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3783646..3784340 | Replicon | chromosome |
Accession | NZ_LR134031 | ||
Organism | Escherichia coli strain NCTC11151 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | EL024_RS18865 | Protein ID | WP_001263500.1 |
Coordinates | 3783646..3784044 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | EL024_RS18870 | Protein ID | WP_000554758.1 |
Coordinates | 3784047..3784340 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL024_RS18840 | 3779011..3779469 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
EL024_RS18845 | 3779730..3781187 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
EL024_RS18850 | 3781244..3781858 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
EL024_RS18855 | 3781855..3782994 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
EL024_RS18860 | 3783184..3783636 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
EL024_RS18865 | 3783646..3784044 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
EL024_RS18870 | 3784047..3784340 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
EL024_RS18875 | 3784392..3785447 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
EL024_RS18880 | 3785518..3786303 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
EL024_RS18885 | 3786275..3787987 | + | 1713 | Protein_3638 | flagellar biosynthesis protein FlhA | - |
EL024_RS24735 | 3788066..3788224 | + | 159 | WP_014639450.1 | hypothetical protein | - |
EL024_RS18890 | 3788307..3788804 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3783646..3803999 | 20353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T286594 WP_001263500.1 NZ_LR134031:c3784044-3783646 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|