Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3553416..3554095 | Replicon | chromosome |
Accession | NZ_LR134031 | ||
Organism | Escherichia coli strain NCTC11151 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | EL024_RS17785 | Protein ID | WP_000057524.1 |
Coordinates | 3553793..3554095 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | EL024_RS17780 | Protein ID | WP_000806442.1 |
Coordinates | 3553416..3553757 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL024_RS17770 | 3549660..3550592 | - | 933 | WP_000883052.1 | glutaminase A | - |
EL024_RS17775 | 3550854..3553358 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
EL024_RS17780 | 3553416..3553757 | - | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
EL024_RS17785 | 3553793..3554095 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL024_RS17790 | 3554228..3555022 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
EL024_RS17795 | 3555226..3555705 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
EL024_RS17800 | 3555729..3556529 | + | 801 | Protein_3425 | hypothetical protein | - |
EL024_RS17805 | 3556526..3557029 | + | 504 | WP_000667000.1 | hypothetical protein | - |
EL024_RS17810 | 3557067..3558719 | - | 1653 | WP_001513633.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3546105..3557029 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T286592 WP_000057524.1 NZ_LR134031:c3554095-3553793 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|