Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 189727..189949 | Replicon | chromosome |
Accession | NZ_LR134031 | ||
Organism | Escherichia coli strain NCTC11151 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | EL024_RS00920 | Protein ID | WP_001295224.1 |
Coordinates | 189842..189949 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 189727..189785 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL024_RS00885 | 185116..186099 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
EL024_RS00890 | 186096..187100 | + | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
EL024_RS00895 | 187130..188401 | - | 1272 | WP_001332306.1 | amino acid permease | - |
EL024_RS00905 | 188877..188984 | + | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
EL024_RS00910 | 189359..189466 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 189727..189785 | - | 59 | - | - | Antitoxin |
EL024_RS00920 | 189842..189949 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
EL024_RS00925 | 190035..191714 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
EL024_RS00930 | 191711..191902 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
EL024_RS00935 | 191899..193470 | - | 1572 | WP_001204957.1 | cellulose biosynthesis protein BcsE | - |
EL024_RS00940 | 193743..193931 | + | 189 | WP_001063314.1 | YhjR family protein | - |
EL024_RS00945 | 193943..194695 | + | 753 | WP_000279545.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T286581 WP_001295224.1 NZ_LR134031:189842-189949 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT286581 NZ_LR134031:c189785-189727 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|