Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3591442..3592136 Replicon chromosome
Accession NZ_LR134000
Organism Escherichia coli strain NCTC9066

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag EL014_RS17510 Protein ID WP_001263493.1
Coordinates 3591442..3591840 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag EL014_RS17515 Protein ID WP_000554757.1
Coordinates 3591843..3592136 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL014_RS17480 3586442..3587686 - 1245 WP_000189541.1 esterase FrsA -
- 3587102..3587182 - 81 NuclAT_11 - -
- 3587102..3587182 - 81 NuclAT_11 - -
- 3587102..3587182 - 81 NuclAT_11 - -
- 3587102..3587182 - 81 NuclAT_11 - -
EL014_RS17485 3587778..3588236 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EL014_RS17490 3588497..3589954 + 1458 WP_001293013.1 cytosol nonspecific dipeptidase -
EL014_RS17495 3590011..3590532 - 522 Protein_3386 peptide chain release factor H -
EL014_RS17500 3590531..3590734 - 204 Protein_3387 RNA ligase RtcB family protein -
EL014_RS17505 3590980..3591432 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
EL014_RS17510 3591442..3591840 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EL014_RS17515 3591843..3592136 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EL014_RS17520 3592188..3593243 - 1056 WP_001226164.1 DNA polymerase IV -
EL014_RS17525 3593314..3594237 - 924 WP_001232547.1 putative lateral flagellar export/assembly protein LafU -
EL014_RS17530 3594240..3595103 - 864 WP_001169518.1 flagellar motor stator protein MotA -
EL014_RS17535 3595116..3595832 - 717 WP_000938730.1 FliA/WhiG family RNA polymerase sigma factor -
EL014_RS17540 3595852..3596319 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T286573 WP_001263493.1 NZ_LR134000:c3591840-3591442 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT286573 WP_000554757.1 NZ_LR134000:c3592136-3591843 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References