Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 660626..661353 | Replicon | chromosome |
| Accession | NZ_LR134000 | ||
| Organism | Escherichia coli strain NCTC9066 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1EX98 |
| Locus tag | EL014_RS03210 | Protein ID | WP_000550192.1 |
| Coordinates | 660626..660940 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL014_RS03215 | Protein ID | WP_000560266.1 |
| Coordinates | 660937..661353 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL014_RS03190 | 656793..657779 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
| EL014_RS03195 | 657858..658541 | - | 684 | WP_001183046.1 | vancomycin high temperature exclusion protein | - |
| EL014_RS03200 | 658618..659121 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| EL014_RS03205 | 659206..660342 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| EL014_RS03210 | 660626..660940 | + | 315 | WP_000550192.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| EL014_RS03215 | 660937..661353 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| EL014_RS03220 | 661398..663416 | - | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| EL014_RS03225 | 663842..666193 | - | 2352 | WP_000695486.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12063.08 Da Isoelectric Point: 10.0409
>T286560 WP_000550192.1 NZ_LR134000:660626-660940 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTPKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTPKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT286560 WP_000560266.1 NZ_LR134000:660937-661353 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|