Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 612035..612834 | Replicon | chromosome |
Accession | NZ_LR134000 | ||
Organism | Escherichia coli strain NCTC9066 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | EL014_RS02970 | Protein ID | WP_000347251.1 |
Coordinates | 612035..612499 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | EL014_RS02975 | Protein ID | WP_012304834.1 |
Coordinates | 612499..612834 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL014_RS02940 | 607036..607470 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
EL014_RS02945 | 607488..608366 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EL014_RS02950 | 608356..609135 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EL014_RS02955 | 609146..609619 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
EL014_RS02960 | 609642..610922 | - | 1281 | WP_000681905.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
EL014_RS02965 | 611171..611980 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
EL014_RS02970 | 612035..612499 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
EL014_RS02975 | 612499..612834 | - | 336 | WP_012304834.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
EL014_RS02980 | 612983..614554 | - | 1572 | WP_001273760.1 | galactarate dehydratase | - |
EL014_RS02985 | 614929..616263 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
EL014_RS02990 | 616279..617049 | + | 771 | WP_001058236.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T286559 WP_000347251.1 NZ_LR134000:c612499-612035 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|