Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3143021..3143670 | Replicon | chromosome |
| Accession | NZ_LR133996 | ||
| Organism | Shimwellia blattae strain NCTC10965 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I2BC85 |
| Locus tag | EL017_RS15190 | Protein ID | WP_002442770.1 |
| Coordinates | 3143021..3143374 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | I2BC86 |
| Locus tag | EL017_RS15195 | Protein ID | WP_002442768.1 |
| Coordinates | 3143371..3143670 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL017_RS15170 | 3138651..3139376 | - | 726 | WP_002442777.1 | type I-E CRISPR-associated protein Cas5/CasD | - |
| EL017_RS15175 | 3139386..3140441 | - | 1056 | WP_002442774.1 | type I-E CRISPR-associated protein Cas7/Cse4/CasC | - |
| EL017_RS15180 | 3140464..3141066 | - | 603 | WP_002442773.1 | type I-E CRISPR-associated protein Cse2/CasB | - |
| EL017_RS15185 | 3141053..3142624 | - | 1572 | WP_002442771.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
| EL017_RS15190 | 3143021..3143374 | + | 354 | WP_002442770.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL017_RS15195 | 3143371..3143670 | + | 300 | WP_002442768.1 | XRE family transcriptional regulator | Antitoxin |
| EL017_RS15200 | 3143711..3146437 | + | 2727 | WP_002442766.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
| EL017_RS15205 | 3146458..3147639 | - | 1182 | WP_014716151.1 | cystathionine beta-lyase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13602.53 Da Isoelectric Point: 8.7754
>T286558 WP_002442770.1 NZ_LR133996:3143021-3143374 [Shimwellia blattae]
MWTVFFGPVFDAWFEEQEPALKEKVLANLRNLEKYGPSLSRPYADTVYGSRYKNMKELRIQYSGYPVRAFFAFDPVRRAI
VLCAGDKSNDKKFYDRMIRIADDEFSAHLATLEGSTK
MWTVFFGPVFDAWFEEQEPALKEKVLANLRNLEKYGPSLSRPYADTVYGSRYKNMKELRIQYSGYPVRAFFAFDPVRRAI
VLCAGDKSNDKKFYDRMIRIADDEFSAHLATLEGSTK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|