Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 673496..673757 | Replicon | chromosome |
Accession | NZ_LR133996 | ||
Organism | Shimwellia blattae strain NCTC10965 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | EL017_RS03200 | Protein ID | WP_014715816.1 |
Coordinates | 673596..673757 (+) | Length | 54 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 673496..673532 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL017_RS03175 | 669191..669481 | + | 291 | WP_002444900.1 | citrate lyase acyl carrier protein | - |
EL017_RS03180 | 669478..670353 | + | 876 | WP_002444902.1 | citrate (pro-3S)-lyase subunit beta | - |
EL017_RS03185 | 670364..671881 | + | 1518 | WP_002444904.1 | citrate lyase subunit alpha | - |
EL017_RS03190 | 671886..672425 | + | 540 | WP_002444905.1 | citrate lyase holo-[acyl-carrier protein] synthase | - |
EL017_RS03195 | 672403..673261 | + | 859 | Protein_619 | triphosphoribosyl-dephospho-CoA synthase CitG | - |
- | 673496..673532 | - | 37 | - | - | Antitoxin |
EL017_RS03200 | 673596..673757 | + | 162 | WP_014715816.1 | Hok/Gef family protein | Toxin |
EL017_RS03205 | 674164..674325 | + | 162 | WP_071840846.1 | Hok/Gef family protein | - |
EL017_RS03210 | 674443..675528 | - | 1086 | WP_002444912.1 | membrane-bound lytic murein transglycosylase MltC | - |
EL017_RS03215 | 675628..675900 | - | 273 | WP_002444915.1 | oxidative damage protection protein | - |
EL017_RS03220 | 675903..676985 | - | 1083 | WP_002444917.1 | A/G-specific adenine glycosylase | - |
EL017_RS03225 | 677142..677861 | + | 720 | WP_002444919.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
EL017_RS03230 | 677861..678187 | + | 327 | WP_002444921.1 | YggL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 649575..675555 | 25980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 5822.12 Da Isoelectric Point: 7.5949
>T286543 WP_014715816.1 NZ_LR133996:673596-673757 [Shimwellia blattae]
MKLSQYSAVWCLLIVCLTLLLLTLIIRPQLCEVRIIQGDREIAAIMACGSGTS
MKLSQYSAVWCLLIVCLTLLLLTLIIRPQLCEVRIIQGDREIAAIMACGSGTS
Download Length: 162 bp
Antitoxin
Download Length: 37 bp
>AT286543 NZ_LR133996:c673532-673496 [Shimwellia blattae]
GGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|