Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 80177..80898 | Replicon | chromosome |
| Accession | NZ_LR133996 | ||
| Organism | Shimwellia blattae strain NCTC10965 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I2B3V7 |
| Locus tag | EL017_RS00345 | Protein ID | WP_002440752.1 |
| Coordinates | 80177..80488 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL017_RS00350 | Protein ID | WP_002440751.1 |
| Coordinates | 80485..80898 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL017_RS00320 | 77005..77835 | + | 831 | WP_002440759.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
| EL017_RS00325 | 78128..78340 | + | 213 | WP_002440757.1 | DUF1471 domain-containing protein | - |
| EL017_RS00330 | 78382..78705 | - | 324 | WP_002440756.1 | AzlD domain-containing protein | - |
| EL017_RS00335 | 78705..79367 | - | 663 | WP_002440754.1 | AzlC family ABC transporter permease | - |
| EL017_RS00340 | 79506..80054 | + | 549 | WP_002440753.1 | XRE family transcriptional regulator | - |
| EL017_RS00345 | 80177..80488 | + | 312 | WP_002440752.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| EL017_RS00350 | 80485..80898 | + | 414 | WP_002440751.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL017_RS00355 | 80957..81271 | - | 315 | WP_034920130.1 | L-rhamnose mutarotase | - |
| EL017_RS00360 | 81283..82431 | - | 1149 | WP_002440748.1 | lactaldehyde reductase | - |
| EL017_RS00365 | 82457..83281 | - | 825 | WP_002440747.1 | rhamnulose-1-phosphate aldolase | - |
| EL017_RS00370 | 83341..84600 | - | 1260 | WP_002440746.1 | L-rhamnose isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.31 Da Isoelectric Point: 9.9315
>T286542 WP_002440752.1 NZ_LR133996:80177-80488 [Shimwellia blattae]
MHIISRAPFDTATKIFPNQAAALDDLYRVLKRENYRSPDEMRMQFPSLDRMKLREKWWVIDVGGGQLRVMFFADFERGKL
FIKHISTHAEYDKLTDYYRRNKE
MHIISRAPFDTATKIFPNQAAALDDLYRVLKRENYRSPDEMRMQFPSLDRMKLREKWWVIDVGGGQLRVMFFADFERGKL
FIKHISTHAEYDKLTDYYRRNKE
Download Length: 312 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15337.62 Da Isoelectric Point: 5.2376
>AT286542 WP_002440751.1 NZ_LR133996:80485-80898 [Shimwellia blattae]
VSYAEAIKTAQALATMFPLLGGSTSRKDYEDALRMVEYLVEHEPDSPLIDMLAARIEKYEDEAPEFAEFNARIASVPAGV
SVLRVIMDQYHLTQSDFEQEIGKKSLVSRILSGQRSLTLAHIKALAARFHIKPELFL
VSYAEAIKTAQALATMFPLLGGSTSRKDYEDALRMVEYLVEHEPDSPLIDMLAARIEKYEDEAPEFAEFNARIASVPAGV
SVLRVIMDQYHLTQSDFEQEIGKKSLVSRILSGQRSLTLAHIKALAARFHIKPELFL
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|