Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 336728..337314 Replicon chromosome
Accession NZ_LR133964
Organism Klebsiella pneumoniae strain NCTC11359

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag EL047_RS01605 Protein ID WP_002920800.1
Coordinates 336946..337314 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag EL047_RS01600 Protein ID WP_004174006.1
Coordinates 336728..336949 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL047_RS01580 332885..333811 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EL047_RS01585 333808..335085 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
EL047_RS01590 335082..335849 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EL047_RS01595 335851..336564 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EL047_RS01600 336728..336949 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL047_RS01605 336946..337314 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL047_RS01610 337586..338902 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EL047_RS01615 339009..339896 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EL047_RS01620 339893..340738 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EL047_RS01625 340740..341810 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 333808..342547 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T286527 WP_002920800.1 NZ_LR133964:336946-337314 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT286527 WP_004174006.1 NZ_LR133964:336728-336949 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References