Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2645532..2646775 | Replicon | chromosome |
Accession | NZ_LR133933 | ||
Organism | Legionella pneumophila strain NCTC12180 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | Q5ZSZ6 |
Locus tag | ELZ66_RS11995 | Protein ID | WP_010948074.1 |
Coordinates | 2645837..2646775 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | Q5ZSZ7 |
Locus tag | ELZ66_RS11990 | Protein ID | WP_010948073.1 |
Coordinates | 2645532..2645840 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ66_RS11965 | 2640968..2641333 | + | 366 | WP_010948069.1 | BRCT domain-containing protein | - |
ELZ66_RS11970 | 2641690..2642055 | - | 366 | WP_010948070.1 | TraK family protein | - |
ELZ66_RS15375 | 2642240..2642380 | - | 141 | WP_153802426.1 | hypothetical protein | - |
ELZ66_RS11975 | 2642383..2644134 | - | 1752 | WP_010948071.1 | DUF927 domain-containing protein | - |
ELZ66_RS11980 | 2644200..2644475 | - | 276 | WP_010948072.1 | helix-turn-helix domain-containing protein | - |
ELZ66_RS11985 | 2645308..2645535 | + | 228 | WP_006870829.1 | helix-turn-helix transcriptional regulator | - |
ELZ66_RS11990 | 2645532..2645840 | + | 309 | WP_010948073.1 | HipA N-terminal domain-containing protein | Antitoxin |
ELZ66_RS11995 | 2645837..2646775 | + | 939 | WP_010948074.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
ELZ66_RS12005 | 2647318..2647932 | + | 615 | WP_010948075.1 | hypothetical protein | - |
ELZ66_RS12010 | 2648088..2648294 | - | 207 | WP_015444115.1 | hypothetical protein | - |
ELZ66_RS12015 | 2648631..2649899 | + | 1269 | WP_010948076.1 | lpg2372 family Dot/Icm T4SS effector | - |
ELZ66_RS12020 | 2650115..2650640 | - | 526 | Protein_2311 | hypothetical protein | - |
ELZ66_RS12025 | 2650640..2651305 | - | 666 | WP_015444114.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36077.81 Da Isoelectric Point: 8.6882
>T286526 WP_010948074.1 NZ_LR133933:2645837-2646775 [Legionella pneumophila]
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|