Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2438508..2438692 | Replicon | chromosome |
Accession | NZ_LR133917 | ||
Organism | Staphylococcus aureus strain NCTC8317 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | ELZ45_RS12680 | Protein ID | WP_000482652.1 |
Coordinates | 2438585..2438692 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2438508..2438568 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ45_RS12655 | 2434019..2434186 | - | 168 | Protein_2343 | hypothetical protein | - |
ELZ45_RS12665 | 2434417..2436150 | - | 1734 | WP_031918671.1 | ABC transporter ATP-binding protein/permease | - |
ELZ45_RS12670 | 2436175..2437938 | - | 1764 | WP_001064809.1 | ABC transporter ATP-binding protein/permease | - |
- | 2438508..2438568 | + | 61 | - | - | Antitoxin |
ELZ45_RS12680 | 2438585..2438692 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ELZ45_RS12685 | 2438826..2439212 | - | 387 | WP_000779357.1 | flippase GtxA | - |
ELZ45_RS12690 | 2439480..2440622 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
ELZ45_RS12695 | 2440682..2441341 | + | 660 | WP_000831298.1 | membrane protein | - |
ELZ45_RS12700 | 2441523..2442734 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
ELZ45_RS12705 | 2442857..2443330 | - | 474 | WP_000456484.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T286517 WP_000482652.1 NZ_LR133917:c2438692-2438585 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286517 NZ_LR133917:2438508-2438568 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|