Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2151764..2151980 | Replicon | chromosome |
Accession | NZ_LR133917 | ||
Organism | Staphylococcus aureus strain NCTC8317 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | ELZ45_RS11125 | Protein ID | WP_001802298.1 |
Coordinates | 2151876..2151980 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2151764..2151819 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ45_RS11105 | 2147958..2148623 | - | 666 | WP_001024093.1 | SDR family oxidoreductase | - |
ELZ45_RS11110 | 2148775..2149095 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
ELZ45_RS11115 | 2149097..2150077 | + | 981 | WP_000019745.1 | CDF family zinc efflux transporter CzrB | - |
ELZ45_RS11120 | 2150343..2151434 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2151764..2151819 | + | 56 | - | - | Antitoxin |
ELZ45_RS11125 | 2151876..2151980 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
ELZ45_RS11135 | 2152660..2152818 | + | 159 | WP_001792784.1 | hypothetical protein | - |
ELZ45_RS11145 | 2153476..2154333 | - | 858 | WP_000370926.1 | Cof-type HAD-IIB family hydrolase | - |
ELZ45_RS11150 | 2154401..2155183 | - | 783 | WP_000908175.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286514 WP_001802298.1 NZ_LR133917:c2151980-2151876 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT286514 NZ_LR133917:2151764-2151819 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|