Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1817771..1817951 | Replicon | chromosome |
Accession | NZ_LR133917 | ||
Organism | Staphylococcus aureus strain NCTC8317 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ELZ45_RS09040 | Protein ID | WP_001801861.1 |
Coordinates | 1817771..1817866 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1817894..1817951 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ELZ45_RS09010 | 1812933..1813583 | + | 651 | WP_072470537.1 | excalibur calcium-binding domain-containing protein | - |
ELZ45_RS09015 | 1813664..1814659 | + | 996 | WP_000070641.1 | DUF4352 domain-containing protein | - |
ELZ45_RS09020 | 1814734..1815360 | + | 627 | WP_000669026.1 | hypothetical protein | - |
ELZ45_RS09025 | 1815401..1815742 | + | 342 | WP_000627537.1 | DUF3969 family protein | - |
ELZ45_RS09030 | 1815843..1816415 | + | 573 | WP_000414215.1 | hypothetical protein | - |
ELZ45_RS09035 | 1816614..1817626 | - | 1013 | Protein_1700 | IS3 family transposase | - |
ELZ45_RS09040 | 1817771..1817866 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1817894..1817951 | - | 58 | - | - | Antitoxin |
ELZ45_RS09045 | 1817989..1818090 | + | 102 | WP_001792025.1 | hypothetical protein | - |
ELZ45_RS09050 | 1818068..1818229 | - | 162 | Protein_1703 | transposase | - |
ELZ45_RS09055 | 1818220..1818714 | - | 495 | Protein_1704 | transposase | - |
ELZ45_RS09060 | 1819166..1820395 | - | 1230 | WP_061826460.1 | restriction endonuclease subunit S | - |
ELZ45_RS09065 | 1820388..1821944 | - | 1557 | WP_094360170.1 | type I restriction-modification system subunit M | - |
ELZ45_RS09070 | 1822109..1822243 | - | 135 | Protein_1707 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1812175..1853340 | 41165 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286507 WP_001801861.1 NZ_LR133917:1817771-1817866 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT286507 NZ_LR133917:c1817951-1817894 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|