Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
| Location | 4372591..4373003 | Replicon | chromosome |
| Accession | NZ_LR130564 | ||
| Organism | Escherichia coli strain MS14387 isolate MS14387 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | U9YSY7 |
| Locus tag | FVE81_RS21370 | Protein ID | WP_000132601.1 |
| Coordinates | 4372662..4373003 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 4372591..4372667 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FVE81_RS21360 | 4369454..4371043 | + | 1590 | WP_001063200.1 | type I restriction-modification system methyltransferase | - |
| FVE81_RS21365 | 4371040..4372434 | + | 1395 | WP_001272445.1 | type I restriction-modification system specificity subunit | - |
| - | 4372591..4372667 | - | 77 | NuclAT_12 | - | Antitoxin |
| - | 4372591..4372667 | - | 77 | NuclAT_12 | - | Antitoxin |
| - | 4372591..4372667 | - | 77 | NuclAT_12 | - | Antitoxin |
| - | 4372591..4372667 | - | 77 | NuclAT_12 | - | Antitoxin |
| - | 4372591..4372667 | - | 77 | NuclAT_13 | - | Antitoxin |
| - | 4372591..4372667 | - | 77 | NuclAT_13 | - | Antitoxin |
| - | 4372591..4372667 | - | 77 | NuclAT_13 | - | Antitoxin |
| - | 4372591..4372667 | - | 77 | NuclAT_13 | - | Antitoxin |
| FVE81_RS21370 | 4372662..4373003 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
| FVE81_RS21375 | 4373165..4374544 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| FVE81_RS21380 | 4374544..4375590 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T286493 WP_000132601.1 NZ_LR130564:4372662-4373003 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT286493 NZ_LR130564:c4372667-4372591 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|