Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3982481..3983131 | Replicon | chromosome |
| Accession | NZ_LR130564 | ||
| Organism | Escherichia coli strain MS14387 isolate MS14387 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | FVE81_RS19550 | Protein ID | WP_000263532.1 |
| Coordinates | 3982790..3983131 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | U9YXQ7 |
| Locus tag | FVE81_RS19545 | Protein ID | WP_000212552.1 |
| Coordinates | 3982481..3982780 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FVE81_RS19515 | 3977929..3978240 | - | 312 | WP_000415004.1 | hypothetical protein | - |
| FVE81_RS19520 | 3978245..3978637 | - | 393 | WP_000285322.1 | flagellar export chaperone FliS | - |
| FVE81_RS19525 | 3978660..3979976 | - | 1317 | WP_000609678.1 | flagellar filament capping protein FliD | - |
| FVE81_RS19535 | 3980181..3981095 | - | 915 | WP_000949083.1 | lateral flagellin LafA | - |
| FVE81_RS19540 | 3981581..3982423 | + | 843 | WP_000022366.1 | winged helix-turn-helix domain-containing protein | - |
| FVE81_RS19545 | 3982481..3982780 | - | 300 | WP_000212552.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| FVE81_RS19550 | 3982790..3983131 | - | 342 | WP_000263532.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FVE81_RS19555 | 3983207..3984184 | - | 978 | WP_001195938.1 | hypothetical protein | - |
| FVE81_RS19560 | 3984201..3985130 | - | 930 | WP_001266799.1 | flagellar hook-associated protein FlgL | - |
| FVE81_RS19565 | 3985145..3986521 | - | 1377 | WP_000367245.1 | flagellar hook-associated protein FlgK | - |
| FVE81_RS19570 | 3986697..3986996 | - | 300 | WP_000867281.1 | rod-binding protein | - |
| FVE81_RS19575 | 3986996..3988096 | - | 1101 | WP_001181876.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13031.86 Da Isoelectric Point: 6.4677
>T286491 WP_000263532.1 NZ_LR130564:c3983131-3982790 [Escherichia coli]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRKHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRKHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|