Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 749870..750563 | Replicon | chromosome |
Accession | NZ_LR130564 | ||
Organism | Escherichia coli strain MS14387 isolate MS14387 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | U9ZN09 |
Locus tag | FVE81_RS03635 | Protein ID | WP_000415585.1 |
Coordinates | 749870..750166 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | FVE81_RS03640 | Protein ID | WP_000650107.1 |
Coordinates | 750168..750563 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FVE81_RS03605 | 745004..746196 | + | 1193 | Protein_706 | Hcp family type VI secretion system effector | - |
FVE81_RS03610 | 746203..746535 | + | 333 | WP_000914691.1 | DUF2645 family protein | - |
FVE81_RS03615 | 746581..747930 | - | 1350 | WP_000673357.1 | two-component system sensor histidine kinase QseC | - |
FVE81_RS03620 | 747927..748586 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
FVE81_RS03625 | 748738..749130 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
FVE81_RS03630 | 749183..749665 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
FVE81_RS03635 | 749870..750166 | + | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
FVE81_RS03640 | 750168..750563 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
FVE81_RS03645 | 750696..752303 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
FVE81_RS03650 | 752441..754699 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T286478 WP_000415585.1 NZ_LR130564:749870-750166 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT286478 WP_000650107.1 NZ_LR130564:750168-750563 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9ZN09 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LU65 |