Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4868704..4869306 | Replicon | chromosome |
Accession | NZ_LR130562 | ||
Organism | Escherichia coli strain MS14384 isolate MS14384 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | EW037_RS23590 | Protein ID | WP_000897305.1 |
Coordinates | 4868995..4869306 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EW037_RS23585 | Protein ID | WP_000356395.1 |
Coordinates | 4868704..4868994 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW037_RS23545 | 4864328..4865230 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
EW037_RS23550 | 4865227..4865862 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
EW037_RS23555 | 4865859..4866788 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
EW037_RS23560 | 4866970..4867212 | - | 243 | WP_001309881.1 | ribbon-helix-helix domain-containing protein | - |
EW037_RS23565 | 4867431..4867649 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
EW037_RS23575 | 4868068..4868346 | - | 279 | WP_001315112.1 | hypothetical protein | - |
EW037_RS23580 | 4868398..4868619 | - | 222 | WP_001550354.1 | hypothetical protein | - |
EW037_RS23585 | 4868704..4868994 | - | 291 | WP_000356395.1 | helix-turn-helix domain-containing protein | Antitoxin |
EW037_RS23590 | 4868995..4869306 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
EW037_RS23595 | 4869535..4870443 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
EW037_RS23600 | 4870611..4872425 | - | 1815 | WP_001550352.1 | hypothetical protein | - |
EW037_RS23605 | 4872841..4873782 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
EW037_RS23610 | 4873827..4874264 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T286474 WP_000897305.1 NZ_LR130562:c4869306-4868995 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|