286467

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3906945..3907639 Replicon chromosome
Accession NZ_LR130562
Organism Escherichia coli strain MS14384 isolate MS14384

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag EW037_RS18960 Protein ID WP_001263491.1
Coordinates 3906945..3907343 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag EW037_RS18965 Protein ID WP_000554755.1
Coordinates 3907346..3907639 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW037_RS18930 3902114..3903358 - 1245 WP_000189541.1 esterase FrsA -
- 3902774..3902854 - 81 NuclAT_10 - -
- 3902774..3902854 - 81 NuclAT_10 - -
- 3902774..3902854 - 81 NuclAT_10 - -
- 3902774..3902854 - 81 NuclAT_10 - -
EW037_RS18935 3903450..3903908 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
EW037_RS18940 3904169..3905626 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
EW037_RS25600 3905683..3906035 - 353 Protein_3640 peptide chain release factor H -
EW037_RS18950 3906031..3906237 - 207 Protein_3641 RtcB family protein -
EW037_RS18955 3906483..3906935 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
EW037_RS18960 3906945..3907343 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
EW037_RS18965 3907346..3907639 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
EW037_RS18970 3907691..3908746 - 1056 WP_001550655.1 DNA polymerase IV -
EW037_RS18975 3908817..3909602 - 786 WP_074157994.1 putative lateral flagellar export/assembly protein LafU -
EW037_RS18980 3909574..3911286 + 1713 Protein_3647 flagellar biosynthesis protein FlhA -
EW037_RS18985 3911391..3911669 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
EW037_RS18990 3911662..3912018 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 3854978..3907639 52661


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T286467 WP_001263491.1 NZ_LR130562:c3907343-3906945 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT286467 WP_000554755.1 NZ_LR130562:c3907639-3907346 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References