Detailed information of TA system TA286441

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 83672..84001
• Replicon: plasmid 2
• Accession: NZ_LR130556
• Organism: Escherichia coli strain MS14385 isolate MS14385

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: EW040_RS25630
• Protein ID: WP_001312861.1
• Coordinates: 83672..83830 (-)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	83874..84001 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EW040_RS25585	78784..79011	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
EW040_RS25590	79099..79776	-	678	WP_001348626.1	PAS domain-containing protein	-
EW040_RS25595	79910..80293	-	384	WP_001151566.1	relaxosome protein TraM	-
EW040_RS25600	80624..81226	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
EW040_RS25605	81523..82344	-	822	WP_001234469.1	DUF945 domain-containing protein	-
EW040_RS25610	82463..82750	-	288	WP_000107535.1	hypothetical protein	-
EW040_RS25615	82775..82981	-	207	WP_000275859.1	hypothetical protein	-
EW040_RS27710	82894..83229	-	336	WP_197725101.1	hypothetical protein	-
EW040_RS25630	83672..83830	-	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	83874..84001	-	128	NuclAT_0	-	Antitoxin
-	83874..84001	-	128	NuclAT_0	-	Antitoxin
-	83874..84001	-	128	NuclAT_0	-	Antitoxin
-	83874..84001	-	128	NuclAT_0	-	Antitoxin
-	85443..85545	-	103	NuclAT_1	-	-
-	85443..85545	-	103	NuclAT_1	-	-
-	85443..85545	-	103	NuclAT_1	-	-
-	85443..85545	-	103	NuclAT_1	-	-
EW040_RS25645	85557..86276	-	720	WP_001276232.1	plasmid SOS inhibition protein A	-
EW040_RS25650	86273..86707	-	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
EW040_RS25655	86762..88720	-	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / mph(A) / sul1 / qacE / aadA5 / sitABCD	iucA / iucB / iucC / iucD / iutA	1..136397	136397

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T286441 WP_001312861.1 NZ_LR130556:c83830-83672 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 128 bp

>AT286441 NZ_LR130556:c84001-83874 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin