Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 83672..84001 | Replicon | plasmid 2 |
| Accession | NZ_LR130556 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | EW040_RS25630 | Protein ID | WP_001312861.1 |
| Coordinates | 83672..83830 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 83874..84001 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS25585 | 78784..79011 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| EW040_RS25590 | 79099..79776 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| EW040_RS25595 | 79910..80293 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| EW040_RS25600 | 80624..81226 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| EW040_RS25605 | 81523..82344 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| EW040_RS25610 | 82463..82750 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| EW040_RS25615 | 82775..82981 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| EW040_RS27710 | 82894..83229 | - | 336 | WP_197725101.1 | hypothetical protein | - |
| EW040_RS25630 | 83672..83830 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 83874..84001 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 83874..84001 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 83874..84001 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 83874..84001 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 85443..85545 | - | 103 | NuclAT_1 | - | - |
| - | 85443..85545 | - | 103 | NuclAT_1 | - | - |
| - | 85443..85545 | - | 103 | NuclAT_1 | - | - |
| - | 85443..85545 | - | 103 | NuclAT_1 | - | - |
| EW040_RS25645 | 85557..86276 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| EW040_RS25650 | 86273..86707 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| EW040_RS25655 | 86762..88720 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / mph(A) / sul1 / qacE / aadA5 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..136397 | 136397 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T286441 WP_001312861.1 NZ_LR130556:c83830-83672 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 128 bp
>AT286441 NZ_LR130556:c84001-83874 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|