Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59333..59572 | Replicon | plasmid 2 |
| Accession | NZ_LR130556 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | EW040_RS25485 | Protein ID | WP_023144756.1 |
| Coordinates | 59333..59467 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 59512..59572 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS27610 | 54820..54960 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| EW040_RS25450 | 55662..56519 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| EW040_RS25455 | 56512..56586 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| EW040_RS27705 | 56583..56717 | - | 135 | Protein_76 | protein CopA/IncA | - |
| EW040_RS25465 | 56823..56975 | - | 153 | WP_072258247.1 | replication protein A | - |
| EW040_RS25470 | 57056..58078 | + | 1023 | WP_000255944.1 | IS21-like element IS100 family transposase | - |
| EW040_RS25475 | 58075..58857 | + | 783 | WP_001300609.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| EW040_RS25480 | 58926..59036 | - | 111 | Protein_80 | replication protein | - |
| EW040_RS25485 | 59333..59467 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 59512..59572 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 59512..59572 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 59512..59572 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 59512..59572 | + | 61 | NuclAT_2 | - | Antitoxin |
| EW040_RS27465 | 59539..59825 | - | 287 | Protein_82 | DUF2726 domain-containing protein | - |
| EW040_RS25500 | 60338..60550 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| EW040_RS25505 | 60681..61241 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| EW040_RS25510 | 61296..62042 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / mph(A) / sul1 / qacE / aadA5 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..136397 | 136397 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T286440 WP_023144756.1 NZ_LR130556:c59467-59333 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT286440 NZ_LR130556:59512-59572 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|