Detailed information of TA system TA286440

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 59333..59572
• Replicon: plasmid 2
• Accession: NZ_LR130556
• Organism: Escherichia coli strain MS14385 isolate MS14385

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: EW040_RS25485
• Protein ID: WP_023144756.1
• Coordinates: 59333..59467 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	59512..59572 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EW040_RS27610	54820..54960	-	141	WP_001333237.1	hypothetical protein	-
EW040_RS25450	55662..56519	-	858	WP_000130640.1	incFII family plasmid replication initiator RepA	-
EW040_RS25455	56512..56586	-	75	WP_031943482.1	RepA leader peptide Tap	-
EW040_RS27705	56583..56717	-	135	Protein_76	protein CopA/IncA	-
EW040_RS25465	56823..56975	-	153	WP_072258247.1	replication protein A	-
EW040_RS25470	57056..58078	+	1023	WP_000255944.1	IS21-like element IS100 family transposase	-
EW040_RS25475	58075..58857	+	783	WP_001300609.1	IS21-like element IS100kyp family helper ATPase IstB	-
EW040_RS25480	58926..59036	-	111	Protein_80	replication protein	-
EW040_RS25485	59333..59467	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	59512..59572	+	61	NuclAT_2	-	Antitoxin
-	59512..59572	+	61	NuclAT_2	-	Antitoxin
-	59512..59572	+	61	NuclAT_2	-	Antitoxin
-	59512..59572	+	61	NuclAT_2	-	Antitoxin
EW040_RS27465	59539..59825	-	287	Protein_82	DUF2726 domain-containing protein	-
EW040_RS25500	60338..60550	-	213	WP_013023861.1	hypothetical protein	-
EW040_RS25505	60681..61241	-	561	WP_000139341.1	fertility inhibition protein FinO	-
EW040_RS25510	61296..62042	-	747	WP_000205718.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / mph(A) / sul1 / qacE / aadA5 / sitABCD	iucA / iucB / iucC / iucD / iutA	1..136397	136397

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T286440 WP_023144756.1 NZ_LR130556:c59467-59333 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

Antitoxin

Nucleotide

• Length: 61 bp

>AT286440 NZ_LR130556:59512-59572 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin