Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4880561..4881163 | Replicon | chromosome |
| Accession | NZ_LR130555 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | EW040_RS23970 | Protein ID | WP_000897305.1 |
| Coordinates | 4880852..4881163 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EW040_RS23965 | Protein ID | WP_000356397.1 |
| Coordinates | 4880561..4880851 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS23940 | 4877063..4877965 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| EW040_RS23945 | 4877962..4878597 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EW040_RS23950 | 4878594..4879523 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| EW040_RS23955 | 4879738..4879956 | - | 219 | WP_001298592.1 | ribbon-helix-helix domain-containing protein | - |
| EW040_RS23965 | 4880561..4880851 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EW040_RS23970 | 4880852..4881163 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| EW040_RS23975 | 4881392..4882300 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
| EW040_RS23980 | 4882364..4883305 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| EW040_RS23985 | 4883350..4883787 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EW040_RS23990 | 4883784..4884656 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| EW040_RS23995 | 4884650..4885249 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| EW040_RS24000 | 4885348..4886133 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T286438 WP_000897305.1 NZ_LR130555:c4881163-4880852 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|