Detailed information of TA system TA286417

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 50610..50879
• Replicon: plasmid 3
• Accession: NZ_LR130554
• Organism: Escherichia coli strain MS14386 isolate MS14386

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: EW035_RS24535
• Protein ID: WP_001312861.1
• Coordinates: 50721..50879 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	50610..50675 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EW035_RS24505	46145..46351	+	207	WP_000275858.1	hypothetical protein	-
EW035_RS24510	46377..46916	+	540	WP_001825195.1	single-stranded DNA-binding protein	-
EW035_RS24515	46979..47212	+	234	WP_000005990.1	DUF905 family protein	-
EW035_RS24520	47278..49236	+	1959	WP_001825193.1	ParB/RepB/Spo0J family partition protein	-
EW035_RS24525	49291..49725	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
EW035_RS24530	49722..50441	+	720	WP_013362833.1	plasmid SOS inhibition protein A	-
EW035_RS25020	50453..50641	-	189	WP_001299721.1	hypothetical protein	-
-	50453..50677	+	225	NuclAT_0	-	-
-	50453..50677	+	225	NuclAT_0	-	-
-	50453..50677	+	225	NuclAT_0	-	-
-	50453..50677	+	225	NuclAT_0	-	-
-	50610..50675	-	66	-	-	Antitoxin
EW035_RS24535	50721..50879	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
EW035_RS24555	51801..52088	+	288	WP_000107544.1	hypothetical protein	-
EW035_RS24560	52209..53030	+	822	WP_001234469.1	DUF945 domain-containing protein	-
EW035_RS24565	53327..53974	-	648	WP_031943493.1	transglycosylase SLT domain-containing protein	-
EW035_RS24570	54251..54634	+	384	WP_000124981.1	relaxosome protein TraM	-
EW035_RS24575	54825..55511	+	687	WP_000332484.1	PAS domain-containing protein	-
EW035_RS24580	55605..55832	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA12 / mph(A) / fosA3 / blaTEM-215	-	1..93927	93927

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T286417 WP_001312861.1 NZ_LR130554:50721-50879 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT286417 NZ_LR130554:c50675-50610 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin