Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 50453..50879 | Replicon | plasmid 3 |
Accession | NZ_LR130554 | ||
Organism | Escherichia coli strain MS14386 isolate MS14386 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | EW035_RS24535 | Protein ID | WP_001312861.1 |
Coordinates | 50721..50879 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 50453..50677 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW035_RS24490 | 45495..45734 | + | 240 | WP_094326110.1 | hypothetical protein | - |
EW035_RS24505 | 46145..46351 | + | 207 | WP_000275858.1 | hypothetical protein | - |
EW035_RS24510 | 46377..46916 | + | 540 | WP_001825195.1 | single-stranded DNA-binding protein | - |
EW035_RS24515 | 46979..47212 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
EW035_RS24520 | 47278..49236 | + | 1959 | WP_001825193.1 | ParB/RepB/Spo0J family partition protein | - |
EW035_RS24525 | 49291..49725 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
EW035_RS24530 | 49722..50441 | + | 720 | WP_013362833.1 | plasmid SOS inhibition protein A | - |
EW035_RS25020 | 50453..50641 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 50453..50677 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 50453..50677 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 50453..50677 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 50453..50677 | + | 225 | NuclAT_0 | - | Antitoxin |
EW035_RS24535 | 50721..50879 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
EW035_RS24555 | 51801..52088 | + | 288 | WP_000107544.1 | hypothetical protein | - |
EW035_RS24560 | 52209..53030 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
EW035_RS24565 | 53327..53974 | - | 648 | WP_031943493.1 | transglycosylase SLT domain-containing protein | - |
EW035_RS24570 | 54251..54634 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
EW035_RS24575 | 54825..55511 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
EW035_RS24580 | 55605..55832 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA12 / mph(A) / fosA3 / blaTEM-215 | - | 1..93927 | 93927 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T286415 WP_001312861.1 NZ_LR130554:50721-50879 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT286415 NZ_LR130554:50453-50677 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|