Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 20177..20603 | Replicon | plasmid 2 |
Accession | NZ_LR130546 | ||
Organism | Escherichia coli strain B36 isolate B36 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | EW036_RS25880 | Protein ID | WP_001312861.1 |
Coordinates | 20445..20603 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 20177..20401 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW036_RS25855 | 16169..16654 | + | 486 | WP_042029316.1 | single-stranded DNA-binding protein | - |
EW036_RS25860 | 16710..16943 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
EW036_RS25865 | 17002..18960 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
EW036_RS25870 | 19015..19449 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
EW036_RS25875 | 19446..20165 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
EW036_RS26685 | 20177..20365 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 20177..20401 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 20177..20401 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 20177..20401 | + | 225 | NuclAT_0 | - | Antitoxin |
- | 20177..20401 | + | 225 | NuclAT_0 | - | Antitoxin |
EW036_RS25880 | 20445..20603 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
EW036_RS25905 | 21522..21809 | + | 288 | WP_000107537.1 | hypothetical protein | - |
EW036_RS25910 | 21930..22751 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
EW036_RS25915 | 23048..23695 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
EW036_RS25920 | 23981..24364 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
EW036_RS25925 | 24558..25244 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
EW036_RS25930 | 25338..25565 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..112588 | 112588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T286374 WP_001312861.1 NZ_LR130546:20445-20603 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT286374 NZ_LR130546:20177-20401 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|