Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4937282..4937884 | Replicon | chromosome |
| Accession | NZ_LR130545 | ||
| Organism | Escherichia coli strain B36 isolate B36 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | EW036_RS24715 | Protein ID | WP_000897302.1 |
| Coordinates | 4937573..4937884 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EW036_RS24710 | Protein ID | WP_000356397.1 |
| Coordinates | 4937282..4937572 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW036_RS24670 | 4932589..4933518 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| EW036_RS24675 | 4933700..4933942 | - | 243 | WP_001068514.1 | ribbon-helix-helix domain-containing protein | - |
| EW036_RS24680 | 4934232..4935080 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| EW036_RS24685 | 4935396..4935845 | + | 450 | WP_032140890.1 | hypothetical protein | - |
| EW036_RS24690 | 4936030..4936248 | - | 219 | WP_001251293.1 | ribbon-helix-helix domain-containing protein | - |
| EW036_RS24700 | 4936645..4936923 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| EW036_RS24710 | 4937282..4937572 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EW036_RS24715 | 4937573..4937884 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| EW036_RS24720 | 4938113..4939021 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| EW036_RS24725 | 4939085..4940026 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| EW036_RS24730 | 4940071..4940508 | - | 438 | WP_000560981.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EW036_RS24735 | 4940505..4941377 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| EW036_RS24740 | 4941371..4941970 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T286373 WP_000897302.1 NZ_LR130545:c4937884-4937573 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|