Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4001612..4002209 | Replicon | chromosome |
Accession | NZ_LR130544 | ||
Organism | Klebsiella variicola strain 03-311-0071 isolate 03-311-0071 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EW041_RS19690 | Protein ID | WP_129766072.1 |
Coordinates | 4001892..4002209 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EW041_RS19685 | Protein ID | WP_012542525.1 |
Coordinates | 4001612..4001899 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW041_RS19655 | 3997473..3997721 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
EW041_RS19660 | 3997738..3998079 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
EW041_RS19665 | 3998110..3999225 | - | 1116 | WP_162493283.1 | MBL fold metallo-hydrolase | - |
EW041_RS19670 | 3999405..3999986 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
EW041_RS19675 | 3999986..4000354 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
EW041_RS19680 | 4000474..4001127 | + | 654 | WP_012968755.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
EW041_RS19685 | 4001612..4001899 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EW041_RS19690 | 4001892..4002209 | - | 318 | WP_129766072.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EW041_RS19695 | 4002394..4003437 | - | 1044 | WP_016160437.1 | DUF2157 domain-containing protein | - |
EW041_RS19705 | 4004105..4004971 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
EW041_RS19710 | 4005080..4006507 | + | 1428 | WP_129766073.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12140.48 Da Isoelectric Point: 11.2767
>T286343 WP_129766072.1 NZ_LR130544:c4002209-4001892 [Klebsiella variicola]
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKMLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKMLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|