Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3943795..3944392 | Replicon | chromosome |
| Accession | NZ_LR130543 | ||
| Organism | Klebsiella variicola strain 04153260899A isolate 04153260899A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1F2LYJ8 |
| Locus tag | EW039_RS19540 | Protein ID | WP_023322191.1 |
| Coordinates | 3944075..3944392 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A6H0BIE0 |
| Locus tag | EW039_RS19535 | Protein ID | WP_023322192.1 |
| Coordinates | 3943795..3944082 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW039_RS19505 | 3939761..3940009 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
| EW039_RS19510 | 3940026..3940368 | - | 343 | Protein_3760 | RamA family antibiotic efflux transcriptional regulator | - |
| EW039_RS19515 | 3940399..3941514 | - | 1116 | WP_172601108.1 | MBL fold metallo-hydrolase | - |
| EW039_RS19520 | 3941694..3942218 | + | 525 | WP_129678742.1 | TetR/AcrR family transcriptional regulator | - |
| EW039_RS19525 | 3942218..3942586 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
| EW039_RS19530 | 3942706..3943359 | + | 654 | WP_008805535.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| EW039_RS19535 | 3943795..3944082 | - | 288 | WP_023322192.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| EW039_RS19540 | 3944075..3944392 | - | 318 | WP_023322191.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EW039_RS19545 | 3944566..3945621 | - | 1056 | WP_023322190.1 | DUF2157 domain-containing protein | - |
| EW039_RS19550 | 3946284..3947150 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
| EW039_RS19555 | 3947259..3948686 | + | 1428 | WP_023322189.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T286328 WP_023322191.1 NZ_LR130543:c3944392-3944075 [Klebsiella variicola]
MFRIVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRIVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LYJ8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H0BIE0 |