Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 341658..342304 | Replicon | chromosome |
| Accession | NZ_LR130543 | ||
| Organism | Klebsiella variicola strain 04153260899A isolate 04153260899A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2V3KK24 |
| Locus tag | EW039_RS01575 | Protein ID | WP_032731351.1 |
| Coordinates | 341658..342005 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1F2LZT5 |
| Locus tag | EW039_RS01580 | Protein ID | WP_008806992.1 |
| Coordinates | 342005..342304 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW039_RS01565 | 337545..338978 | + | 1434 | WP_004202133.1 | glycogen synthase GlgA | - |
| EW039_RS01570 | 338996..341443 | + | 2448 | WP_008806990.1 | glycogen phosphorylase | - |
| EW039_RS01575 | 341658..342005 | + | 348 | WP_032731351.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EW039_RS01580 | 342005..342304 | + | 300 | WP_008806992.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| EW039_RS01585 | 342367..343875 | - | 1509 | WP_008806993.1 | glycerol-3-phosphate dehydrogenase | - |
| EW039_RS01590 | 344080..344409 | + | 330 | WP_004202138.1 | thiosulfate sulfurtransferase GlpE | - |
| EW039_RS01595 | 344460..345290 | + | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
| EW039_RS01600 | 345340..346098 | + | 759 | WP_008806995.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13474.43 Da Isoelectric Point: 6.2327
>T286320 WP_032731351.1 NZ_LR130543:341658-342005 [Klebsiella variicola]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKETITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V3KK24 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZT5 |