286303

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 336567..337153 Replicon chromosome
Accession NZ_LR130541
Organism Klebsiella pneumoniae strain AJ218 isolate AJ218

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag EW045_RS01600 Protein ID WP_021312828.1
Coordinates 336785..337153 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag EW045_RS01595 Protein ID WP_004174006.1
Coordinates 336567..336788 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW045_RS01575 332724..333650 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EW045_RS01580 333647..334924 + 1278 WP_048269558.1 branched chain amino acid ABC transporter permease LivM -
EW045_RS01585 334921..335688 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EW045_RS01590 335690..336403 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EW045_RS01595 336567..336788 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EW045_RS01600 336785..337153 + 369 WP_021312828.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EW045_RS01605 337426..338742 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EW045_RS01610 338849..339736 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EW045_RS01615 339733..340578 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EW045_RS01620 340580..341650 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 333647..342387 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13578.96 Da        Isoelectric Point: 8.5493

>T286303 WP_021312828.1 NZ_LR130541:336785-337153 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT286303 WP_004174006.1 NZ_LR130541:336567-336788 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References